Company page

Company Section

Company Highlights

Mobile Pros Llc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Mobile Pros LLC. Unknown Emails Available? Yes Wallington, NJ
973-365-1812 Wireless Software Not Available None Found
If you don't want to waste too much time looking for company information regarding Mobile Pros Llc., a Wireless software company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Mobile Pros Llc.'s CEO , and other Mobile Pros Llc. email format addresses within the @mobileprosllc.com domain. Mobile Pros Llc. is based in Wallington, NJ. If you sign up for our free trial you will see our email@mobileprosllc.com addresses.
Modules Technology Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Modules Technology Inc Unknown Emails Available? Yes San Jose, CA
408-392-0808 Electronics Not Available Microsoft Windows OS
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Modules Technology Inc email format addresses with the domain of @modulestech.com. Modules Technology Inc, a Electronics company has its main office in San Jose, CA. If you sign up for our free trial you will see our email@modulestech.com addresses.
Mondo Media
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Mondo Media John Evershed Emails Available? Yes San Francisco, CA
415-865-2700 Animation 2.5 - 5 Million Google Adsense, Google Publisher Tag
Lead411 offers quality contact information on a variety of companies including that of Mondo Media's CEO John Evershed. The company profile also contains facebook info, linkedin accounts, phone numbers, cfo contacts, and Mondo Media email addresses with the domain format of @mondomedia.com. Mondo Media, is in the Animation field. If you sign up for our free trial you will see our email@mondomedia.com addresses.
Montrose Chamber Of Commerce
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Montrose Chamber of Commerce Unknown Emails Available? No Montrose, CO
970-249-5000 Non-Profit Not Available Google Adsense, Google Analytics
This includes Montrose Chamber of Commerce email format addresses with the @montrosechamber.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Montrose Chamber of Commerce is a Non-profit business with its headquarters based in Montrose, CO. If you sign up for our free trial you will see our email@montrosechamber.com addresses.
Morin's Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Morin's Inc Dave Morin Emails Available? Yes Attleboro, MA
888-552-7822 Food Processing 10 - 20 Million Google Analytics, Google Content
Morin's Inc is a Attleboro, MA-based company working within the Food processing industry. You can find Morin's Inc email format addresses here with the domain @morins.com. If you sign up for our free trial you will see our email@morins.com addresses.
Mostad & Christensen, Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Mostad & Christensen, Inc Unknown Emails Available? No Oak Harbor, WA
360-679-4164 Accounting Not Available Google Analytics, Google Ajax
Mostad & Christensen, Inc, is a company that works within the Accounting. This Oak Harbor, WA-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Mostad & Christensen, Inc email format addresses with the @mostad.com domain as well as quality contact info regarding Mostad & Christensen, Inc's CEO . They have their head office in Oak Harbor, WA. If you sign up for our free trial you will see our email@mostad.com addresses.
Mountain Valley Spring Company
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Mountain Valley Spring Company Unknown Emails Available? Yes Hot Springs, AR
501-624-1635 Consumer Products 20 - 50 Million Google Adsense, Google Analytics
Mountain Valley Spring Company, is in the Consumer products industry. Their main office can be found in Hot Springs, AR, and they can be contacted through Mountain Valley Spring Company email using the domain @mountainvalleyspring.com format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@mountainvalleyspring.com addresses.
Ms Precision Components, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
MS Precision Components, LLC Unknown Emails Available? No Webberville, MI
517-223-1059 Industrial Equip Not Available Google Analytics, Linux OS
MS Precision Components, LLC, is in the Industrial equip industry. Their main office can be found in Webberville, MI, and they can be contacted through MS Precision Components, LLC email using the domain @msi.ms-spaichingen.de format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@msi.ms-spaichingen.de addresses.
Multicase Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Multicase Inc Unknown Emails Available? Yes Shaker Heights, OH
216-831-3740 Software 1 - 2.5 Million Google Analytics, Google Ajax
If you don't want to waste too much time looking for company information regarding Multicase Inc, a Software company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Multicase Inc's CEO , and other Multicase Inc email format addresses within the @multicase.com domain. Multicase Inc is based in Shaker Heights, OH. If you sign up for our free trial you will see our email@multicase.com addresses.
Music Institute Of Chicago Alumni
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Music Institute of Chicago Alumni Unknown Emails Available? Yes Evanston, IL
847-905-1500 Arts and Crafts 10 - 20 Million Google Analytics, New Relic
Music Institute of Chicago Alumni, a company that works within the Arts and crafts industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Music Institute Of Chicago Alumni email addresses with the @musicinst.orgdomain format. They have their head office in Evanston, IL. If you sign up for our free trial you will see our email@musicinst.org addresses.
Mikes Auto Body
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Mikes Auto Body Brennan Rose Emails Available? Yes Concord, CA
855-340-1739 Automotive 20 - 50 Million Google Adsense, Google Analytics
Mikes Auto Body, a Automotive company, is based in Concord, CA. They can be reached through Mikes Auto Body email format addresses indicated on their Lead411 profile with a domain of @mautobody.com. If you sign up for our free trial you will see our email@mautobody.com addresses.
Merryvale Vineyards
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Merryvale Vineyards Ren Schlatter Emails Available? Yes St. Helena, CA
707-963-7777 Beverages (Alcoholic) 1 - 2.5 Million Google Analytics, Dotomi
If you don't want to waste too much time looking for company information regarding Merryvale Vineyards, a Beverages (alcoholic) company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Merryvale Vineyards's CEO Ren Schlatter, and other Merryvale Vineyards email format addresses within the @merryvale.com domain. Merryvale Vineyards is based in St. Helena, CA. If you sign up for our free trial you will see our email@merryvale.com addresses.
Moses Legal Search
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Moses Legal Search Unknown Emails Available? No Austin, TX
512-236-3048 Legal Not Available Google Analytics, Quicktime
Moses Legal Search, a Legal company, is based in Austin, TX. They can be reached through Moses Legal Search email format addresses indicated on their Lead411 profile with a domain of @moseslegal.com. If you sign up for our free trial you will see our email@moseslegal.com addresses.
Mobile Technologies Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Mobile Technologies Inc Chris Remy Emails Available? Yes Hillsboro, OR
503-648-6500 Electronics 20 - 50 Million Google Analytics, Pardot
If you don't want to waste too much time looking for company information regarding Mobile Technologies Inc, a Electronics company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Mobile Technologies Inc's CEO Chris Remy, and other Mobile Technologies Inc email format addresses within the @mobiletechinc.com domain. Mobile Technologies Inc is based in Hillsboro, OR. If you sign up for our free trial you will see our email@mobiletechinc.com addresses.
Mhp Real Estate Services
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
MHP Real Estate Services Unknown Emails Available? Yes New York, NY
212-944-4747 Real Estate 10 - 20 Million Google Analytics, Google Ajax
Lead411 offers quality contact information on a variety of companies including that of MHP Real Estate Services's CEO . The company profile also contains facebook info, linkedin accounts, phone numbers, cfo contacts, and MHP Real Estate Services email addresses with the domain format of @mhpnyc.com. MHP Real Estate Services, is in the Real estate field. If you sign up for our free trial you will see our email@mhpnyc.com addresses.
Med Advantage
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Med Advantage Unknown Emails Available? Yes University, FL
407-282-5131 Hospitals/Clinics 2.5 - 5 Million Google Analytics, New Relic
Med Advantage, a company that works within the Hospitals/clinics industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Med Advantage email addresses with the @med-advantage.comdomain format. They have their head office in University, FL. If you sign up for our free trial you will see our email@med-advantage.com addresses.
Motor City Industrial
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Motor City Industrial Joe Stephens Emails Available? Yes Hazel Park, MI
248-399-2830 Specialty 2.5 - 5 Million Google Analytics, Squarespace
This includes Motor City Industrial email format addresses with the @motorcityindustrial.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Motor City Industrial is a Specialty business with its headquarters based in Hazel Park, MI. If you sign up for our free trial you will see our email@motorcityindustrial.com addresses.
Managed It Services For The Midwest
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Managed IT Services for the midwest Unknown Emails Available? Yes Plainfield, IL
630-357-8385 Technology Consulting/Services 1 - 2.5 Million Google Analytics, Quicktime
Managed IT Services for the midwest, a company that works within the Technology consulting/services industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Managed It Services For The Midwest email addresses with the @bksteam.comdomain format. They have their head office in Plainfield, IL. If you sign up for our free trial you will see our email@bksteam.com addresses.
Motor Systems, Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Motor Systems, Inc. Unknown Emails Available? Yes Milford, OH
513-248-3090 Industrial Equip 2.5 - 5 Million Google Analytics, Google Ajax
Motor Systems, Inc., a Industrial equip company, is based in Milford, OH. They can be reached through Motor Systems, Inc. email format addresses indicated on their Lead411 profile with a domain of @motorsystems.com. If you sign up for our free trial you will see our email@motorsystems.com addresses.
My Independent Financial Adviser
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Independent Financial Adviser Unknown Emails Available? No Woolloomooloo, NSW
1300 069 432 13000 Financial Services Not Available Google Analytics, Google Ajax
This member of the Financial services industry is located in Woolloomooloo, NSW and you can find important contact information regarding significant company contacts on their Lead411 profile like linkedin, phone numbers, facebook and cfo details. The profile also contains My Independent Financial Adviser email addresses which have a domain of @myindependentfinancialadviser.com.au format. If you sign up for our free trial you will see our email@myindependentfinancialadviser.com.au addresses.