| Mobile Pros Llc. |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Mobile Pros LLC. |
Unknown |
Emails Available?
Yes |
Wallington, NJ |
| 973-365-1812 |
Wireless Software |
Not Available |
None Found |
| If you don't want to waste too much time looking for company information regarding Mobile Pros Llc., a Wireless software company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Mobile Pros Llc.'s CEO , and other Mobile Pros Llc. email format addresses within the @mobileprosllc.com domain. Mobile Pros Llc. is based in Wallington, NJ. If you sign up for our free trial you will see our email@mobileprosllc.com addresses. |
|
| Modules Technology Inc |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Modules Technology Inc |
Unknown |
Emails Available?
Yes |
San Jose, CA |
| 408-392-0808 |
Electronics |
Not Available |
Microsoft Windows OS |
| The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Modules Technology Inc email format addresses with the domain of @modulestech.com. Modules Technology Inc, a Electronics company has its main office in San Jose, CA. If you sign up for our free trial you will see our email@modulestech.com addresses. |
|
| Mondo Media |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Mondo Media |
John Evershed |
Emails Available?
Yes |
San Francisco, CA |
| 415-865-2700 |
Animation |
2.5 - 5 Million |
Google Adsense, Google Publisher Tag |
| Lead411 offers quality contact information on a variety of companies including that of Mondo Media's CEO John Evershed. The company profile also contains facebook info, linkedin accounts, phone numbers, cfo contacts, and Mondo Media email addresses with the domain format of @mondomedia.com. Mondo Media, is in the Animation field. If you sign up for our free trial you will see our email@mondomedia.com addresses. |
|
| Montrose Chamber Of Commerce |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Montrose Chamber of Commerce |
Unknown |
Emails Available?
No |
Montrose, CO |
| 970-249-5000 |
Non-Profit |
Not Available |
Google Adsense, Google Analytics |
| This includes Montrose Chamber of Commerce email format addresses with the @montrosechamber.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Montrose Chamber of Commerce is a Non-profit business with its headquarters based in Montrose, CO. If you sign up for our free trial you will see our email@montrosechamber.com addresses. |
|
| Morin's Inc |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Morin's Inc |
Dave Morin |
Emails Available?
Yes |
Attleboro, MA |
| 888-552-7822 |
Food Processing |
10 - 20 Million |
Google Analytics, Google Content |
| Morin's Inc is a Attleboro, MA-based company working within the Food processing industry. You can find Morin's Inc email format addresses here with the domain @morins.com. If you sign up for our free trial you will see our email@morins.com addresses. |
|
| Mostad & Christensen, Inc |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Mostad & Christensen, Inc |
Unknown |
Emails Available?
No |
Oak Harbor, WA |
| 360-679-4164 |
Accounting |
Not Available |
Google Analytics, Google Ajax |
| Mostad & Christensen, Inc, is a company that works within the Accounting. This Oak Harbor, WA-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Mostad & Christensen, Inc email format addresses with the @mostad.com domain as well as quality contact info regarding Mostad & Christensen, Inc's CEO . They have their head office in Oak Harbor, WA. If you sign up for our free trial you will see our email@mostad.com addresses. |
|
| Mountain Valley Spring Company |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Mountain Valley Spring Company |
Unknown |
Emails Available?
Yes |
Hot Springs, AR |
| 501-624-1635 |
Consumer Products |
20 - 50 Million |
Google Adsense, Google Analytics |
| Mountain Valley Spring Company, is in the Consumer products industry. Their main office can be found in Hot Springs, AR, and they can be contacted through Mountain Valley Spring Company email using the domain @mountainvalleyspring.com format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@mountainvalleyspring.com addresses. |
|
| Ms Precision Components, Llc |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| MS Precision Components, LLC |
Unknown |
Emails Available?
No |
Webberville, MI |
| 517-223-1059 |
Industrial Equip |
Not Available |
Google Analytics, Linux OS |
| MS Precision Components, LLC, is in the Industrial equip industry. Their main office can be found in Webberville, MI, and they can be contacted through MS Precision Components, LLC email using the domain @msi.ms-spaichingen.de format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@msi.ms-spaichingen.de addresses. |
|
| Multicase Inc |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Multicase Inc |
Unknown |
Emails Available?
Yes |
Shaker Heights, OH |
| 216-831-3740 |
Software |
1 - 2.5 Million |
Google Analytics, Google Ajax |
| If you don't want to waste too much time looking for company information regarding Multicase Inc, a Software company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Multicase Inc's CEO , and other Multicase Inc email format addresses within the @multicase.com domain. Multicase Inc is based in Shaker Heights, OH. If you sign up for our free trial you will see our email@multicase.com addresses. |
|
| Music Institute Of Chicago Alumni |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Music Institute of Chicago Alumni |
Unknown |
Emails Available?
Yes |
Evanston, IL |
| 847-905-1500 |
Arts and Crafts |
10 - 20 Million |
Google Analytics, New Relic |
| Music Institute of Chicago Alumni, a company that works within the Arts and crafts industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Music Institute Of Chicago Alumni email addresses with the @musicinst.orgdomain format. They have their head office in Evanston, IL. If you sign up for our free trial you will see our email@musicinst.org addresses. |
|
| Mikes Auto Body |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Mikes Auto Body |
Brennan Rose |
Emails Available?
Yes |
Concord, CA |
| 855-340-1739 |
Automotive |
20 - 50 Million |
Google Adsense, Google Analytics |
| Mikes Auto Body, a Automotive company, is based in Concord, CA. They can be reached through Mikes Auto Body email format addresses indicated on their Lead411 profile with a domain of @mautobody.com. If you sign up for our free trial you will see our email@mautobody.com addresses. |
|
| Merryvale Vineyards |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Merryvale Vineyards |
Ren Schlatter |
Emails Available?
Yes |
St. Helena, CA |
| 707-963-7777 |
Beverages (Alcoholic) |
1 - 2.5 Million |
Google Analytics, Dotomi |
| If you don't want to waste too much time looking for company information regarding Merryvale Vineyards, a Beverages (alcoholic) company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Merryvale Vineyards's CEO Ren Schlatter, and other Merryvale Vineyards email format addresses within the @merryvale.com domain. Merryvale Vineyards is based in St. Helena, CA. If you sign up for our free trial you will see our email@merryvale.com addresses. |
|
| Moses Legal Search |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Moses Legal Search |
Unknown |
Emails Available?
No |
Austin, TX |
| 512-236-3048 |
Legal |
Not Available |
Google Analytics, Quicktime |
| Moses Legal Search, a Legal company, is based in Austin, TX. They can be reached through Moses Legal Search email format addresses indicated on their Lead411 profile with a domain of @moseslegal.com. If you sign up for our free trial you will see our email@moseslegal.com addresses. |
|
| Mobile Technologies Inc |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Mobile Technologies Inc |
Chris Remy |
Emails Available?
Yes |
Hillsboro, OR |
| 503-648-6500 |
Electronics |
20 - 50 Million |
Google Analytics, Pardot |
| If you don't want to waste too much time looking for company information regarding Mobile Technologies Inc, a Electronics company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Mobile Technologies Inc's CEO Chris Remy, and other Mobile Technologies Inc email format addresses within the @mobiletechinc.com domain. Mobile Technologies Inc is based in Hillsboro, OR. If you sign up for our free trial you will see our email@mobiletechinc.com addresses. |
|
| Mhp Real Estate Services |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| MHP Real Estate Services |
Unknown |
Emails Available?
Yes |
New York, NY |
| 212-944-4747 |
Real Estate |
10 - 20 Million |
Google Analytics, Google Ajax |
| Lead411 offers quality contact information on a variety of companies including that of MHP Real Estate Services's CEO . The company profile also contains facebook info, linkedin accounts, phone numbers, cfo contacts, and MHP Real Estate Services email addresses with the domain format of @mhpnyc.com. MHP Real Estate Services, is in the Real estate field. If you sign up for our free trial you will see our email@mhpnyc.com addresses. |
|
| Med Advantage |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Med Advantage |
Unknown |
Emails Available?
Yes |
University, FL |
| 407-282-5131 |
Hospitals/Clinics |
2.5 - 5 Million |
Google Analytics, New Relic |
| Med Advantage, a company that works within the Hospitals/clinics industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Med Advantage email addresses with the @med-advantage.comdomain format. They have their head office in University, FL. If you sign up for our free trial you will see our email@med-advantage.com addresses. |
|
| Motor City Industrial |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Motor City Industrial |
Joe Stephens |
Emails Available?
Yes |
Hazel Park, MI |
| 248-399-2830 |
Specialty |
2.5 - 5 Million |
Google Analytics, Squarespace |
| This includes Motor City Industrial email format addresses with the @motorcityindustrial.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Motor City Industrial is a Specialty business with its headquarters based in Hazel Park, MI. If you sign up for our free trial you will see our email@motorcityindustrial.com addresses. |
|
| Managed It Services For The Midwest |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Managed IT Services for the midwest |
Unknown |
Emails Available?
Yes |
Plainfield, IL |
| 630-357-8385 |
Technology Consulting/Services |
1 - 2.5 Million |
Google Analytics, Quicktime |
| Managed IT Services for the midwest, a company that works within the Technology consulting/services industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Managed It Services For The Midwest email addresses with the @bksteam.comdomain format. They have their head office in Plainfield, IL. If you sign up for our free trial you will see our email@bksteam.com addresses. |
|
| Motor Systems, Inc. |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| Motor Systems, Inc. |
Unknown |
Emails Available?
Yes |
Milford, OH |
| 513-248-3090 |
Industrial Equip |
2.5 - 5 Million |
Google Analytics, Google Ajax |
| Motor Systems, Inc., a Industrial equip company, is based in Milford, OH. They can be reached through Motor Systems, Inc. email format addresses indicated on their Lead411 profile with a domain of @motorsystems.com. If you sign up for our free trial you will see our email@motorsystems.com addresses. |
|
| My Independent Financial Adviser |
| Company/Phone |
CEO/Industry |
Email / Co Size |
City / IT Technologies |
| My Independent Financial Adviser |
Unknown |
Emails Available?
No |
Woolloomooloo, NSW |
| 1300 069 432 13000 |
Financial Services |
Not Available |
Google Analytics, Google Ajax |
| This member of the Financial services industry is located in Woolloomooloo, NSW and you can find important contact information regarding significant company contacts on their Lead411 profile like linkedin, phone numbers, facebook and cfo details. The profile also contains My Independent Financial Adviser email addresses which have a domain of @myindependentfinancialadviser.com.au format. If you sign up for our free trial you will see our email@myindependentfinancialadviser.com.au addresses. |
|
