Company page

Company Highlights

My Home Group Real Estate
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Home Group Real Estate Unknown Emails Available? Yes Scottsdale, AZ
480-685-2760 Real Estate 10 - 20 Million Google Analytics, Vimeo
My Home Group Real Estate, a business led by CEO , is part of the Real estate industry. My Home Group Real Estate email with the @myhomegroup.com format, you can check their Lead411 profile. They hold their main office in Scottsdale, AZ and more data like cfo contacts and linkedin data can be found within our profiles. If you sign up for our free trial you will see our email@myhomegroup.com addresses.
My Home My Haven
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Home My Haven Unknown Emails Available? No ,
Other Not Available Google Analytics, StatCounter
My Home My Haven, a company that works within the Other industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and My Home My Haven email addresses with the @myhomemyhaven.comdomain format. They have their head office in , . If you sign up for our free trial you will see our email@myhomemyhaven.com addresses.
My Home My Planet
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Home My Planet Unknown Emails Available? Yes Mt. Kisco, NY
Construction Services Not Available Google Analytics, StatCounter
Looking for company data regarding My Home My Planet's CEO or CFO? My Home My Planet is part of the Construction services field and are located in the area of Mt. Kisco, NY. Some of the helpful data that can be found on their Lead411 profile include My Home My Planet email addresses marked by the domain format @myhomemyplanet.com. Other contact information could contain cfo names, phone numbers, linkedin profiles, corporate contacts, and facebook profiles. If you sign up for our free trial you will see our email@myhomemyplanet.com addresses.
My Home Online Business
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Home My Planet Unknown Emails Available? Yes Mt. Kisco, NY
Construction Services Not Available Google Analytics, StatCounter
My Home Rocks
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Home My Planet Unknown Emails Available? Yes Mt. Kisco, NY
Construction Services Not Available Google Analytics, StatCounter
My Home T.l.c. Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Home My Planet Unknown Emails Available? Yes Mt. Kisco, NY
Construction Services Not Available Google Analytics, StatCounter
My Home, Your Home Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Home, Your Home Inc Connie Palmer Emails Available? Yes ,
414 874-2560 Other Not Available MediaElement.js, Viddler
My Home, Your Home Inc is a , -based company working within the Other industry. You can find My Home, Your Home Inc email format addresses here with the domain @mhyh.org. If you sign up for our free trial you will see our email@mhyh.org addresses.
My Homecare
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Homecare Unknown Emails Available? No Consett, ENG
Healthcare Facilities/Services Not Available Google Analytics, Google Ajax
My Homecare, is a company that works within the Healthcare facilities/services. This Consett, ENG-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and My Homecare email format addresses with the @my-homecare.co.uk domain as well as quality contact info regarding My Homecare's CEO . They have their head office in Consett, ENG. If you sign up for our free trial you will see our email@my-homecare.co.uk addresses.
My Homeland Realty Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Homeland Realty Inc. Unknown Emails Available? No Southfield, MI
248-281-2590 Unknown Not Available Google Publisher Tag, Google Analytics
My Homeland Realty Inc., a company that works within the Unknown industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and My Homeland Realty Inc. email addresses with the @myhir.comdomain format. They have their head office in Southfield, MI. If you sign up for our free trial you will see our email@myhir.com addresses.
My Homepulse, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Homeland Realty Inc. Unknown Emails Available? No Southfield, MI
248-281-2590 Unknown Not Available Google Publisher Tag, Google Analytics
My Hope Chest
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Hope Chest Alisa Savoretti Emails Available? No Seminole, FL
Other Not Available Google Analytics, Google Content
Have you been searching for My Hope Chest's contact information for hours? Have you been trying to find My Hope Chest's domain format email addresses?. My Hope Chest is a Other and is based in Seminole, FL and more information like linkedin facts, phone numbers, cfo executives and facebook profiles can be found within the Lead411 profile. If you sign up for our free trial you will see our email@myhopechest.org addresses.
My Hospitality Sales Pro
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Hospitality Sales Pro Unknown Emails Available? No ,
Leisure/Hospitality Not Available Google Analytics, AddThis
My Hospitality Sales Pro, is a company that works within the Leisure/hospitality. This , -based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and My Hospitality Sales Pro email format addresses with the @myhospitalitysalespro.com domain as well as quality contact info regarding My Hospitality Sales Pro's CEO . They have their head office in , . If you sign up for our free trial you will see our email@myhospitalitysalespro.com addresses.
My Hospitality Supplies
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Hospitality Supplies Unknown Emails Available? No Mcdonough, GA
(864) 659-0017 Leisure/Hospitality Not Available Google Analytics, StatCounter
My Hospitality Supplies, is in the Leisure/hospitality industry. Their main office can be found in Mcdonough, GA, and they can be contacted through My Hospitality Supplies email using the domain @myhospitalitysupplies.com format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@myhospitalitysupplies.com addresses.
My Hotel Wedding
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Hospitality Supplies Unknown Emails Available? No Mcdonough, GA
(864) 659-0017 Leisure/Hospitality Not Available Google Analytics, StatCounter
My House
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Hospitality Supplies Unknown Emails Available? No Mcdonough, GA
(864) 659-0017 Leisure/Hospitality Not Available Google Analytics, StatCounter
My House Broker
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My House Broker Unknown Emails Available? Yes , ENG
Real Estate Not Available None Found
Lead411 offers quality contact information on a variety of companies including that of My House Broker's CEO . The company profile also contains facebook info, linkedin accounts, phone numbers, cfo contacts, and My House Broker email addresses with the domain format of @myhousebroker.co.uk. My House Broker, is in the Real estate field. If you sign up for our free trial you will see our email@myhousebroker.co.uk addresses.
My House Design Build Team Ltd.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My House Design Build Team Ltd. Unknown Emails Available? No Surrey,
604.694.6873 Construction/Agriculture Not Available Google Analytics, Yoast Plugins
My House Design Build Team Ltd., a business led by CEO , is part of the Construction/agriculture industry. My House Design Build Team Ltd. email with the @myhousedesignbuild.com format, you can check their Lead411 profile. They hold their main office in Surrey, and more data like cfo contacts and linkedin data can be found within our profiles. If you sign up for our free trial you will see our email@myhousedesignbuild.com addresses.
My House Fitness
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My House Fitness Unknown Emails Available? Yes Winter Springs, FL
407-826-1640 Other 1 - 2.5 Million Google Analytics, Yoast Plugins
Want to know how to get in touch with them? Lead411 has the email addresses of My House Fitness's top officials for the company domain @MyHouseFitness.com format. My House Fitness is a Other company centred in Winter Springs, FL and our profiles could include more contact information like cfo people, linkedin contacts, phone numbers and facebook pages. If you sign up for our free trial you will see our email@MyHouseFitness.com addresses.
My House Plumbing & Hardware
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My House Fitness Unknown Emails Available? Yes Winter Springs, FL
407-826-1640 Other 1 - 2.5 Million Google Analytics, Yoast Plugins
My House Productions
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My House Fitness Unknown Emails Available? Yes Winter Springs, FL
407-826-1640 Other 1 - 2.5 Million Google Analytics, Yoast Plugins
My House Renovation
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My House Renovation Unknown Emails Available? Yes North Highlands, CA
800-311-7008 Construction Services Not Available Google Analytics, New Relic
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and My House Renovation email format addresses with the domain of @myhouserenovation.net. My House Renovation, a Construction services company has its main office in North Highlands, CA. If you sign up for our free trial you will see our email@myhouserenovation.net addresses.
My House Your Home
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My House Your Home Unknown Emails Available? No ,
Real Estate Not Available None Found
Want to know how to get in touch with them? Lead411 has the email addresses of My House Your Home's top officials for the company domain @myhouseyourhome.net format. My House Your Home is a Real estate company centred in , and our profiles could include more contact information like cfo people, linkedin contacts, phone numbers and facebook pages. If you sign up for our free trial you will see our email@myhouseyourhome.net addresses.
My Hr
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
MY HR Unknown Emails Available? Yes Stamford, CT
(888) 606-6947 Staffing 1 - 2.5 Million WordPress, iPhone OS
Lead411 offers quality contact information on a variety of companies including that of MY HR's CEO . The company profile also contains facebook info, linkedin accounts, phone numbers, cfo contacts, and MY HR email addresses with the domain format of @myhrsupplier.com. MY HR, is in the Staffing field. If you sign up for our free trial you will see our email@myhrsupplier.com addresses.
My Independent Financial Adviser
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Independent Financial Adviser Unknown Emails Available? No Woolloomooloo, NSW
1300 069 432 13000 Financial Services Not Available Google Analytics, Google Ajax
If you don't want to waste too much time looking for company information regarding My Independent Financial Adviser, a Financial services company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of My Independent Financial Adviser's CEO , and other My Independent Financial Adviser email format addresses within the @myindependentfinancialadviser.com.au domain. My Independent Financial Adviser is based in Woolloomooloo, NSW. If you sign up for our free trial you will see our email@myindependentfinancialadviser.com.au addresses.
My Innerview
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My InnerView Michael Hays Emails Available? No Lincoln, NE
800-501-3884 Service Providers < 500k jQuery.com, AspDotNetStorefront
Looking for company data regarding My InnerView's CEO or CFO? My InnerView is part of the Service providers field and are located in the area of Lincoln, NE. Some of the helpful data that can be found on their Lead411 profile include My InnerView email addresses marked by the domain format @myinnerview.com. Other contact information could contain cfo names, phone numbers, linkedin profiles, corporate contacts, and facebook profiles. If you sign up for our free trial you will see our email@myinnerview.com addresses.
My Instant Guru
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Instant Guru Michael Hosey Emails Available? No Los Angeles, CA
877-430-4878 Wireless Software Networking Not Available Google Adsense, Google Analytics
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and My Instant Guru email format addresses with the domain of @myinstantguru.com. My Instant Guru, a Wireless software networking company has its main office in Los Angeles, CA. If you sign up for our free trial you will see our email@myinstantguru.com addresses.
My Insurance Broker
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Insurance Broker Unknown Emails Available? Yes Richmond Hill, ON
1 877 482-5001 Insurance Not Available Google Ajax, CloudFlare
My Insurance Broker is a Richmond Hill, ON-based company working within the Insurance industry. You can find My Insurance Broker email format addresses here with the domain @myinsurancebroker.com. If you sign up for our free trial you will see our email@myinsurancebroker.com addresses.
My Insurance Expert
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Insurance Expert Unknown Emails Available? Yes Troy, MI
248-637-8064 Health/Accident 100 - 500 Million Google Analytics, Amazon AWS / Cloudfront
My Insurance Expert, is a company that works within the Health/accident. This Troy, MI-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and My Insurance Expert email format addresses with the @myinsuranceexpert.com domain as well as quality contact info regarding My Insurance Expert's CEO . They have their head office in Troy, MI. If you sign up for our free trial you will see our email@myinsuranceexpert.com addresses.
My Investment Advisor, Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Investment Advisor, Inc. Unknown Emails Available? No St. George, UT
303-800-1608 Financial Services Not Available Google Analytics, AddThis
My Investment Advisor, Inc., a business led by CEO , is part of the Financial services industry. My Investment Advisor, Inc. email with the @myinvestmentadvisor.com format, you can check their Lead411 profile. They hold their main office in St. George, UT and more data like cfo contacts and linkedin data can be found within our profiles. If you sign up for our free trial you will see our email@myinvestmentadvisor.com addresses.
My Investments
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
MY Investments Henry Mundt Emails Available? No Chigwell, ENG
Real Estate Not Available None Found
Looking for company data regarding MY Investments's CEO or CFO? MY Investments is part of the Real estate field and are located in the area of Chigwell, ENG. Some of the helpful data that can be found on their Lead411 profile include MY Investments email addresses marked by the domain format @myinvestments.org. Other contact information could contain cfo names, phone numbers, linkedin profiles, corporate contacts, and facebook profiles. If you sign up for our free trial you will see our email@myinvestments.org addresses.
My Irish Jeweler
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Irish Jeweler Ciaran Vipond Emails Available? No Dublin, Leinster
Other Not Available jsDelivr, jQuery.com
This member of the Other industry is located in Dublin, Leinster and you can find important contact information regarding significant company contacts on their Lead411 profile like linkedin, phone numbers, facebook and cfo details. The profile also contains My Irish Jeweler email addresses which have a domain of @myirishjeweler.com format. If you sign up for our free trial you will see our email@myirishjeweler.com addresses.
My Island Home
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Island Home Unknown Emails Available? No ,
Accounting Not Available Google Analytics
My Island Home, is a company that works within the Accounting. This , -based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and My Island Home email format addresses with the @myislandhome.com.au domain as well as quality contact info regarding My Island Home's CEO . They have their head office in , . If you sign up for our free trial you will see our email@myislandhome.com.au addresses.
My It Guy Corp.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My IT Guy Corp. Unknown Emails Available? No Kitchener, ON
519-496-6463 Technology Consulting/Services Not Available Google Analytics, Google Ajax
This includes My IT Guy Corp. email format addresses with the @myitguy.ca domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. My IT Guy Corp. is a Technology consulting/services business with its headquarters based in Kitchener, ON. If you sign up for our free trial you will see our email@myitguy.ca addresses.
My It Systems
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My IT Guy Corp. Unknown Emails Available? No Kitchener, ON
519-496-6463 Technology Consulting/Services Not Available Google Analytics, Google Ajax
My It, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My IT, LLC Unknown Emails Available? No ,
619-721-6089 Technology Consulting/Services Not Available None Found
Looking for company data regarding My IT, LLC's CEO or CFO? My IT, LLC is part of the Technology consulting/services field and are located in the area of , . Some of the helpful data that can be found on their Lead411 profile include My IT, LLC email addresses marked by the domain format @mybtcs.com. Other contact information could contain cfo names, phone numbers, linkedin profiles, corporate contacts, and facebook profiles. If you sign up for our free trial you will see our email@mybtcs.com addresses.
My It, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My IT, LLC Unknown Emails Available? Yes Metairie, LA
504-888-6948 Technology Consulting/Services 2.5 - 5 Million Google Analytics, New Relic
This includes My IT, LLC email format addresses with the @myitsupport.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. My IT, LLC is a Technology consulting/services business with its headquarters based in Metairie, LA. If you sign up for our free trial you will see our email@myitsupport.com addresses.
My Jet Manager, Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Jet Manager, Inc. Unknown Emails Available? No Boca Raton, FL
561-361-7211 Other Not Available Google Analytics, MediaElement.js
My Jet Manager, Inc., is a company that works within the Other. This Boca Raton, FL-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and My Jet Manager, Inc. email format addresses with the @myjetmanager.com domain as well as quality contact info regarding My Jet Manager, Inc.'s CEO . They have their head office in Boca Raton, FL. If you sign up for our free trial you will see our email@myjetmanager.com addresses.
My Job Referrals
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Jet Manager, Inc. Unknown Emails Available? No Boca Raton, FL
561-361-7211 Other Not Available Google Analytics, MediaElement.js
My Kid's Pediatrician
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Kid's Pediatrician Unknown Emails Available? No Jourdanton, TX
830-769-1045 Medical Equipment Not Available AspDotNetStorefront, YouTube
My Kid's Pediatrician, a business led by CEO , is part of the Medical equipment industry. My Kid's Pediatrician email with the @MyKidsPediatrician.com format, you can check their Lead411 profile. They hold their main office in Jourdanton, TX and more data like cfo contacts and linkedin data can be found within our profiles. If you sign up for our free trial you will see our email@MyKidsPediatrician.com addresses.
My Kids Dentist - Pacific Dental Services
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
My Kid's Pediatrician Unknown Emails Available? No Jourdanton, TX
830-769-1045 Medical Equipment Not Available AspDotNetStorefront, YouTube