Company page

Company Highlights

Premier Properties Of New England
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties of New England Unknown Emails Available? Yes Concord, MA
781-419-9300 Real Estate Not Available Google Adsense, Google Analytics
Premier Properties of New England, is a company that works within the Real estate. This Concord, MA-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Properties of New England email format addresses with the @premierpropertiesne.com domain as well as quality contact info regarding Premier Properties of New England's CEO . They have their head office in Concord, MA. If you sign up for our free trial you will see our email@premierpropertiesne.com addresses.
Premier Properties Of South Florida, Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties of South Florida, Inc. Unknown Emails Available? Yes Jupiter, FL
561-747-6600 Real Estate 1 - 2.5 Million Google Analytics, Google Ajax
Premier Properties of South Florida, Inc., is in the Real estate industry. Their main office can be found in Jupiter, FL, and they can be contacted through Premier Properties of South Florida, Inc. email using the domain @pposf.com format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@pposf.com addresses.
Premier Properties Of Southwes
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties of Southwes Unknown Emails Available? No Naples, FL
239-261-4300 Real Estate Not Available Google Analytics, New Relic
Have you been searching for Premier Properties of Southwes's contact information for hours? Have you been trying to find Premier Properties of Southwes's domain format email addresses?. Premier Properties of Southwes is a Real estate and is based in Naples, FL and more information like linkedin facts, phone numbers, cfo executives and facebook profiles can be found within the Lead411 profile. If you sign up for our free trial you will see our email@lutgert.net addresses.
Premier Properties Of Southwest Florida, Inc. Realtors
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties of Southwest Florida, Inc. Realtors Unknown Emails Available? No Naples, FL
770-832-8394 Real Estate 2.5 - 5 Million TradeDesk, Google Analytics
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Premier Properties of Southwest Florida, Inc. Realtors email format addresses with the domain of @premier-properties.com. Premier Properties of Southwest Florida, Inc. Realtors, a Real estate company has its main office in Naples, FL. If you sign up for our free trial you will see our email@premier-properties.com addresses.
Premier Properties Of Sw Fl
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties Of Sw Fl Unknown Emails Available? No North Haven, CT
239-642-2222 Real Estate Not Available None Found
Want to know how to get in touch with them? Lead411 has the email addresses of Premier Properties Of Sw Fl's top officials for the company domain @premiermail.net format. Premier Properties Of Sw Fl is a Real estate company centred in North Haven, CT and our profiles could include more contact information like cfo people, linkedin contacts, phone numbers and facebook pages. If you sign up for our free trial you will see our email@premiermail.net addresses.
Premier Properties Of Sw Fl
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties of SW FL Unknown Emails Available? No Marco Island, FL
239-642-4111 Real Estate Not Available None Found
Premier Properties of SW FL, is in the Real estate industry. Their main office can be found in Marco Island, FL, and they can be contacted through Premier Properties of SW FL email using the domain @realestatesalesmarcoisland.com format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@realestatesalesmarcoisland.com addresses.
Premier Properties Of Sw Fl
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties of SW FL Unknown Emails Available? No Marco Island, FL
239-642-4111 Real Estate Not Available None Found
Premier Properties of SW FL, a Real estate company, is based in Marco Island, FL. They can be reached through Premier Properties of SW FL email format addresses indicated on their Lead411 profile with a domain of @marcowilsons.com. If you sign up for our free trial you will see our email@marcowilsons.com addresses.
Premier Properties Perth
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties Perth Unknown Emails Available? No ,
Unknown Not Available None Found
Premier Properties Perth, a business led by CEO , is part of the Unknown industry. Premier Properties Perth email with the @ format, you can check their Lead411 profile. They hold their main office in , and more data like cfo contacts and linkedin data can be found within our profiles.
Premier Properties Real Estate
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties Real Estate Unknown Emails Available? No Hidden Valley, IN
812-537-9665 Real Estate 2.5 - 5 Million Google Analytics, Google Ajax
Premier Properties Real Estate, a Real estate company, is based in Hidden Valley, IN. They can be reached through Premier Properties Real Estate email format addresses indicated on their Lead411 profile with a domain of @premierpropertiesre.com. If you sign up for our free trial you will see our email@premierpropertiesre.com addresses.
Premier Properties Unlimited
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties Real Estate Unknown Emails Available? No Hidden Valley, IN
812-537-9665 Real Estate 2.5 - 5 Million Google Analytics, Google Ajax
Premier Properties, Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Properties Real Estate Unknown Emails Available? No Hidden Valley, IN
812-537-9665 Real Estate 2.5 - 5 Million Google Analytics, Google Ajax
Premier Property
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Unknown Emails Available? No ,
Unknown Not Available None Found
This includes Premier Property email format addresses with the @ domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Premier Property is a Unknown business with its headquarters based in , .
Premier Property & Pool Management
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property & Pool Management Unknown Emails Available? No Lewes, DE
Other Not Available None Found
This member of the Other industry is located in Lewes, DE and you can find important contact information regarding significant company contacts on their Lead411 profile like linkedin, phone numbers, facebook and cfo details. The profile also contains Premier Property & Pool Management email addresses which have a domain of @premierpropertyandpool.com format. If you sign up for our free trial you will see our email@premierpropertyandpool.com addresses.
Premier Property Consultants
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Consultants Unknown Emails Available? No Stratford, ON
Real Estate Not Available None Found
Premier Property Consultants, a Real estate company, is based in Stratford, ON. They can be reached through Premier Property Consultants email format addresses indicated on their Lead411 profile with a domain of @premierpropertyconsultants.ca. If you sign up for our free trial you will see our email@premierpropertyconsultants.ca addresses.
Premier Property Group
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Consultants Unknown Emails Available? No Stratford, ON
Real Estate Not Available None Found
Premier Property Inspections Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Inspections LLC Unknown Emails Available? No Castle Rock, CO
303-459-4100 Real Estate 1 - 2.5 Million None Found
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Premier Property Inspections LLC email format addresses with the domain of @premier-inspector.com. Premier Property Inspections LLC, a Real estate company has its main office in Castle Rock, CO. If you sign up for our free trial you will see our email@premier-inspector.com addresses.
Premier Property Lawyers
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Lawyers Unknown Emails Available? No Narborough, ENG
Legal Not Available None Found
Premier Property Lawyers, is a company that works within the Legal. This Narborough, ENG-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Property Lawyers email format addresses with the @premierpropertylawyers.com domain as well as quality contact info regarding Premier Property Lawyers's CEO . They have their head office in Narborough, ENG. If you sign up for our free trial you will see our email@premierpropertylawyers.com addresses.
Premier Property Management
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management Unknown Emails Available? Yes Garland, TX
972-240-6187 Real Estate 10 - 20 Million jQuery.com, WordPress
Premier Property Management, is a company that works within the Real estate. This Garland, TX-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Property Management email format addresses with the @premierpmtx.com domain as well as quality contact info regarding Premier Property Management's CEO . They have their head office in Garland, TX. If you sign up for our free trial you will see our email@premierpmtx.com addresses.
Premier Property Management
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management Unknown Emails Available? No Sanford, FL
407-322-8922 Real Estate Not Available Joomla!, Google Content
Premier Property Management, a Real estate company, is based in Sanford, FL. They can be reached through Premier Property Management email format addresses indicated on their Lead411 profile with a domain of @premiermgmtcfl.com. If you sign up for our free trial you will see our email@premiermgmtcfl.com addresses.
Premier Property Management
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management Unknown Emails Available? No Dundee, ENG
Real Estate Not Available tumblr, Yoast Plugins
Premier Property Management is a Dundee, ENG-based company working within the Real estate industry. You can find Premier Property Management email format addresses here with the domain @premierpropertymanagement.co.uk. If you sign up for our free trial you will see our email@premierpropertymanagement.co.uk addresses.
Premier Property Management Group
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management Group Kent Clothier Emails Available? No Cordova, TN
901-751-7979 Real Estate 2.5 - 5 Million None Found
This includes Premier Property Management Group email format addresses with the @premierpropertymemphis.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Premier Property Management Group is a Real estate business with its headquarters based in Cordova, TN. If you sign up for our free trial you will see our email@premierpropertymemphis.com addresses.
Premier Property Management Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management Group Kent Clothier Emails Available? No Cordova, TN
901-751-7979 Real Estate 2.5 - 5 Million None Found
Premier Property Management Niagara
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management Niagara Unknown Emails Available? No ,
Real Estate Not Available None Found
Premier Property Management Niagara, a Real estate company, is based in , . They can be reached through Premier Property Management Niagara email format addresses indicated on their Lead411 profile with a domain of @ppmniagara.com. If you sign up for our free trial you will see our email@ppmniagara.com addresses.
Premier Property Management Services
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management Services Unknown Emails Available? No Beaver Falls, PA
Other Not Available None Found
If you don't want to waste too much time looking for company information regarding Premier Property Management Services, a Other company, check out their Lead411 profile. Our profiles have linkedin data, phone numbers, cfo contacts, and more. It contains helpful contact information regarding top company officials, including that of Premier Property Management Services's CEO , and other Premier Property Management Services email format addresses within the @rentwithpremier.com domain. Premier Property Management Services is based in Beaver Falls, PA. If you sign up for our free trial you will see our email@rentwithpremier.com addresses.
Premier Property Management, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Management, LLC Unknown Emails Available? No ,
Real Estate Not Available None Found
Premier Property Management, LLC, a company that works within the Real estate industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Property Management, Llc email addresses with the @premierpropertiesri.comdomain format. They have their head office in , . If you sign up for our free trial you will see our email@premierpropertiesri.com addresses.
Premier Property Marketing Group
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Marketing Group Unknown Emails Available? No Austin, TX
512 763-2076 Real Estate 1 - 2.5 Million Amazon AWS / Cloudfront, Vimeo
Premier Property Marketing Group, is in the Real estate industry. Their main office can be found in Austin, TX, and they can be contacted through Premier Property Marketing Group email using the domain @ppmgaustin.com format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@ppmgaustin.com addresses.
Premier Property Preservation, Llc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Preservation, LLC. Unknown Emails Available? No Rancho Cordova, CA
Financial Services Not Available None Found
Premier Property Preservation, LLC. is a Rancho Cordova, CA-based company working within the Financial services industry. You can find Premier Property Preservation, LLC. email format addresses here with the domain @premierpreservationllc.com. If you sign up for our free trial you will see our email@premierpreservationllc.com addresses.
Premier Property Services
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Services Unknown Emails Available? No ,
Construction Services Not Available None Found
Want to know how to get in touch with them? Lead411 has the email addresses of Premier Property Services's top officials for the company domain @ppsboston.com format. Premier Property Services is a Construction services company centred in , and our profiles could include more contact information like cfo people, linkedin contacts, phone numbers and facebook pages. If you sign up for our free trial you will see our email@ppsboston.com addresses.
Premier Property Services Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
PREMIER PROPERTY SERVICES LLC Unknown Emails Available? No , MI
313-822-9000 Real Estate Not Available None Found
Want to know how to get in touch with them? Lead411 has the email addresses of PREMIER PROPERTY SERVICES LLC's top officials for the company domain @investmentreo.com format. PREMIER PROPERTY SERVICES LLC is a Real estate company centred in , MI and our profiles could include more contact information like cfo people, linkedin contacts, phone numbers and facebook pages. If you sign up for our free trial you will see our email@investmentreo.com addresses.
Premier Property Services, Llc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Services, LLC. Unknown Emails Available? No ,
Real Estate Not Available None Found
Premier Property Services, LLC., a Real estate company, is based in , . They can be reached through Premier Property Services, LLC. email format addresses indicated on their Lead411 profile with a domain of @premierpropertyservices.biz. If you sign up for our free trial you will see our email@premierpropertyservices.biz addresses.
Premier Property Solutions Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Solutions Inc. Unknown Emails Available? No Winnipeg, MB
Real Estate Not Available None Found
Premier Property Solutions Inc. is a Winnipeg, MB-based company working within the Real estate industry. You can find Premier Property Solutions Inc. email format addresses here with the domain @premierpropertysolutions.ca. If you sign up for our free trial you will see our email@premierpropertysolutions.ca addresses.
Premier Property Solutions, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Solutions, LLC Unknown Emails Available? Yes Boston, MA
617-345-0045 Real Estate 2.5 - 5 Million Google Analytics, AddThis
Premier Property Solutions, LLC, a business led by CEO , is part of the Real estate industry. Premier Property Solutions, LLC email with the @premierpropertyma.com format, you can check their Lead411 profile. They hold their main office in Boston, MA and more data like cfo contacts and linkedin data can be found within our profiles. If you sign up for our free trial you will see our email@premierpropertyma.com addresses.
Premier Property Tax
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Tax Unknown Emails Available? No Cypress, TX
281-304-5222 Real Estate Not Available None Found
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Premier Property Tax email format addresses with the domain of @premierpropertytax.com. Premier Property Tax, a Real estate company has its main office in Cypress, TX. If you sign up for our free trial you will see our email@premierpropertytax.com addresses.
Premier Property Ventures Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Property Ventures LLC Unknown Emails Available? No San Diego, CA
858-863-6225 Real Estate Not Available None Found
Have you been searching for Premier Property Ventures LLC's contact information for hours? Have you been trying to find Premier Property Ventures LLC's domain format email addresses?. Premier Property Ventures LLC is a Real estate and is based in San Diego, CA and more information like linkedin facts, phone numbers, cfo executives and facebook profiles can be found within the Lead411 profile. If you sign up for our free trial you will see our email@premierpropertyventures.com addresses.
Premier Prosthetics
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Prosthetics Unknown Emails Available? No Le Roy, NY
800-726-1966 Hospitals/Clinics Not Available None Found
Lead411 offers quality contact information on a variety of companies including that of Premier Prosthetics's CEO . The company profile also contains facebook info, linkedin accounts, phone numbers, cfo contacts, and Premier Prosthetics email addresses with the domain format of @premierprosthetics.com. Premier Prosthetics, is in the Hospitals/clinics field. If you sign up for our free trial you will see our email@premierprosthetics.com addresses.
Premier Prosthetics And Orthotics
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Prosthetics and Orthotics Unknown Emails Available? No ,
Medical Equipment 1 - 2.5 Million None Found
Premier Prosthetics and Orthotics, a company that works within the Medical equipment industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Prosthetics And Orthotics email addresses with the @premierpando.comdomain format. They have their head office in , . If you sign up for our free trial you will see our email@premierpando.com addresses.
Premier Protection & Investigations
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Protection & Investigations Unknown Emails Available? No Knoxville, TN
865-325-0500 Legal Not Available None Found
Premier Protection & Investigations, a company that works within the Legal industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Protection & Investigations email addresses with the @pi-tn.comdomain format. They have their head office in Knoxville, TN. If you sign up for our free trial you will see our email@pi-tn.com addresses.
Premier Protection Insurance Services, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Protection Insurance Services, LLC Unknown Emails Available? No ,
954-467-8738 Insurance Not Available Google Analytics, jsDelivr
Want to know how to get in touch with them? Lead411 has the email addresses of Premier Protection Insurance Services, LLC's top officials for the company domain @premierprotectioninsurance.com format. Premier Protection Insurance Services, LLC is a Insurance company centred in , and our profiles could include more contact information like cfo people, linkedin contacts, phone numbers and facebook pages. If you sign up for our free trial you will see our email@premierprotectioninsurance.com addresses.
Premier Protective Packaging
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Protective Packaging Unknown Emails Available? Yes Grand Rapids, MI
616-791-7400 Packaging/Containers 1 - 2.5 Million Google Adsense, Google Analytics
Premier Protective Packaging, is a company that works within the Packaging/containers. This Grand Rapids, MI-based business. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Protective Packaging email format addresses with the @foambubble.com domain as well as quality contact info regarding Premier Protective Packaging's CEO . They have their head office in Grand Rapids, MI. If you sign up for our free trial you will see our email@foambubble.com addresses.
Premier Protective Security Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Protective Security Inc Unknown Emails Available? No Nashville, TN
615-549-0075 Security Services Not Available None Found
This includes Premier Protective Security Inc email format addresses with the @ppsinctn.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Premier Protective Security Inc is a Security services business with its headquarters based in Nashville, TN. If you sign up for our free trial you will see our email@ppsinctn.com addresses.
Premier Protective Services
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Protective Services Unknown Emails Available? No Euclid, OH
216-731-4000 Security Services 20 - 50 Million Google Content, tumblr
Premier Protective Services, a company that works within the Security services industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Protective Services email addresses with the @thepremierteam.netdomain format. They have their head office in Euclid, OH. If you sign up for our free trial you will see our email@thepremierteam.net addresses.
Premier Proteins
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Proteins Unknown Emails Available? Yes Kearney, MO
816-628-0078 Specialty Not Available Google Analytics, Yoast Plugins
This includes Premier Proteins email format addresses with the @premierproteins.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Premier Proteins is a Specialty business with its headquarters based in Kearney, MO. If you sign up for our free trial you will see our email@premierproteins.com addresses.
Premier Psychiatric & Sleep Medicine Associates, Pllc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
PREMIER PSYCHIATRIC & SLEEP MEDICINE ASSOCIATES, PLLC Unknown Emails Available? No MCKINNEY, TX
Other Not Available None Found
Want to know how to get in touch with them? Lead411 has the email addresses of PREMIER PSYCHIATRIC & SLEEP MEDICINE ASSOCIATES, PLLC's top officials for the company domain @riazmd.com format. PREMIER PSYCHIATRIC & SLEEP MEDICINE ASSOCIATES, PLLC is a Other company centred in Mckinney, TX and our profiles could include more contact information like cfo people, linkedin contacts, phone numbers and facebook pages. If you sign up for our free trial you will see our email@riazmd.com addresses.
Premier Psychiatric Group, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Psychiatric Group, LLC Unknown Emails Available? No Lincoln, NE
402-476-6060 Hospitals/Clinics 5 - 10 Million Google Analytics, New Relic
Looking for company data regarding Premier Psychiatric Group, LLC's CEO or CFO? Premier Psychiatric Group, LLC is part of the Hospitals/clinics field and are located in the area of Lincoln, NE. Some of the helpful data that can be found on their Lead411 profile include Premier Psychiatric Group, LLC email addresses marked by the domain format @premierpsych.com. Other contact information could contain cfo names, phone numbers, linkedin profiles, corporate contacts, and facebook profiles. If you sign up for our free trial you will see our email@premierpsych.com addresses.
Premier Psychiatric Services, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Psychiatric Services, LLC Unknown Emails Available? No Baton Rouge, LA
Hospitals/Clinics Not Available None Found
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Premier Psychiatric Services, LLC email format addresses with the domain of @premierpsychiatricservicesllc.weebly.com. Premier Psychiatric Services, LLC, a Hospitals/clinics company has its main office in Baton Rouge, LA. If you sign up for our free trial you will see our email@premierpsychiatricservicesllc.weebly.com addresses.
Premier Psychiatry
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Psychiatry Unknown Emails Available? No Atlanta, GA
Hospitals/Clinics Not Available None Found
Premier Psychiatry, a company that works within the Hospitals/clinics industry. Their profile on Lead411 presents significant contact information such as cfo contacts, phone numbers, linkedin data, and Premier Psychiatry email addresses with the @premier-psychiatry.comdomain format. They have their head office in Atlanta, GA. If you sign up for our free trial you will see our email@premier-psychiatry.com addresses.
Premier Pt
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier PT Unknown Emails Available? No North Charleston, SC
843-797-5167 Healthcare Facilities/Services Not Available None Found
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Premier PT email format addresses with the domain of @. Premier PT, a Healthcare facilities/services company has its main office in North Charleston, SC.
Premier Public Adjusters
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Public Adjusters Unknown Emails Available? No Philadelphia, PA
215-551-5307 Insurance Not Available None Found
Premier Public Adjusters is a Philadelphia, PA-based company working within the Insurance industry. You can find Premier Public Adjusters email format addresses here with the domain @premierpublicadjusters.com. If you sign up for our free trial you will see our email@premierpublicadjusters.com addresses.
Premier Publishing
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
PREMIER PUBLISHING Jeanette Dunn Emails Available? No Washington, DC
Publishing Not Available None Found
PREMIER PUBLISHING, is in the Publishing industry. Their main office can be found in Washington, DC, and they can be contacted through PREMIER PUBLISHING email using the domain @premierpublishing.com format, some important contact information like linkedin data, phone numbers, contacts for cfos, etc of which can be found on their Lead411 profile. If you sign up for our free trial you will see our email@premierpublishing.com addresses.
Premier Publishing Ltd
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
PREMIER PUBLISHING Jeanette Dunn Emails Available? No Washington, DC
Publishing Not Available None Found
Premier Pump & Supply Inc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Pump & Supply Inc Unknown Emails Available? No Rancho Cordova, CA
916-638-0344 Other Not Available Google Analytics, WordPress
Premier Pump & Supply Inc, a Other company, is based in Rancho Cordova, CA. They can be reached through Premier Pump & Supply Inc email format addresses indicated on their Lead411 profile with a domain of @premierpumpsupply.com. If you sign up for our free trial you will see our email@premierpumpsupply.com addresses.
Premier Pump And Power, Llc
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Pump and Power, LLC Unknown Emails Available? No Vancouver, WA
360-574-4519 Energy 1 - 2.5 Million None Found
This includes Premier Pump and Power, LLC email format addresses with the @premierpumpandpower.com domain, contacts, phone numbers, linkedin info, cfo employees, and facebook profiles. Premier Pump and Power, LLC is a Energy business with its headquarters based in Vancouver, WA. If you sign up for our free trial you will see our email@premierpumpandpower.com addresses.
Premier Pump, Inc.
Company/Phone CEO/Industry Email / Co Size City / IT Technologies
Premier Pump, Inc. Unknown Emails Available? Yes Seven Hills, OH
216-739-1600 Constr/Agric Machinery 1 - 2.5 Million Google Ajax, Yoast Plugins
The company profile also contains facebook info, phone numbers, linkedin accounts, cfo contacts, and Premier Pump, Inc. email format addresses with the domain of @premierpump.com. Premier Pump, Inc., a Constr/agric machinery company has its main office in Seven Hills, OH. If you sign up for our free trial you will see our email@premierpump.com addresses.